PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g15474.1.p
Common NameBRADI_1g15474
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 831aa    MW: 95484.4 Da    PI: 8.4345
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g15474.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR164.92.2e-20107232290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk......................................tekerrtra 56 
                        Yn+YA  +GFs++ ++s++s  ++ + k+++vC+k   +++ +++                                       +k+rr+++
  Bradi1g15474.1.p 107 HYNAYACVMGFSIKSNTSRRSAYTNLVEKQQLVCNKFRMPKPMDDAagkssnptgnsskarrdesssdeehvdapnedpllfrkVVKKRRRES 199
                       6*****************************************99999************************************9999999*** PP

              FAR1  57 etrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        ++tgCkak++vk+  +g+wev+ ++ eHnHel 
  Bradi1g15474.1.p 200 IKQTGCKAKMTVKLI-EGRWEVIFFVAEHNHELI 232
                       ***************.****************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.8E-18107232IPR004330FAR1 DNA binding domain
PfamPF105512.6E-8355387IPR018289MULE transposase domain
PROSITE profilePS509669.235609645IPR007527Zinc finger, SWIM-type
PfamPF044346.4E-4614644IPR007527Zinc finger, SWIM-type
SMARTSM005750.0059620647IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 831 aa     Download sequence    Send to blast
MALDNVFNQP IAPQLSRLLC MRKWESLTTI RIAENKRLVG APIAGDSTAI ADDTNVVAED  60
SVGLAEDTTG VACDAPDNIE QEIECSSQPQ EPFLGMRFDT LAGAKAHYNA YACVMGFSIK  120
SNTSRRSAYT NLVEKQQLVC NKFRMPKPMD DAAGKSSNPT GNSSKARRDE SSSDEEHVDA  180
PNEDPLLFRK VVKKRRRESI KQTGCKAKMT VKLIEGRWEV IFFVAEHNHE LITKPSLTKY  240
LLSHKNISPE EEAFLRILDD CNLETGQMMT LMSTFYANGF IVPYTTKTIS NFRSKIRSER  300
KGDDMAETVS YFMVKQKEDP SFYFNVKLDE DERVELLFWV DGVARKAYKE SYHDCISFDT  360
TYLTNQYNMP FAPFIGINRH GQSFMLGSNI WMQWDYAMRA SIANVFPNTV HRNCRWHIMK  420
KAQEKLGSFL GRRPAVSQDY NECVDMSMTP DEFEQKWATF LAKHQLEEHA DFAHLYNIRR  480
TWVPCYFRDC FFPFLQSTQR SEGFNAVLKR YVNSRNSILN FVKQYEKIQV KILVKEGGND  540
YRTDHLTQAT WSSYPIEKQA FATYTRDIYV KFRDEFKLTG RYNVRLQQND LYRLEPNMTC  600
CQFYGSRSYL VLAQVGDEEY SCECGKVKRD GLLCCHILKV FTHLGIDEIP ERYIMRRWTQ  660
NAVPRKVARP DETQPDALPP ESLKQIRMAN LSVKYGELAR IGCCLDAANA TAEKYIRVTK  720
AEITHLNLTR RKDAKRRRET AARNYSTCPH NCTAPCSNFG WCSSNYNPNT RNNSSLNGEW  780
CSDGACPRNC NFWLCSSNCV MLPRNYNRRP RNSSSLNGKW CSDGIGFSRP *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233530.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0Q3GTY50.0A0A0Q3GTY5_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-83FAR1-related sequence 5